Item Rajaa... Posted May 23, 2010 Report Posted May 23, 2010 @mr.mogudu thank u fr d complement.....nd *=:[img]http://i44.tinypic.com/cj968.jpg[/img]
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=Item Rajaa... link=topic=69802.msg742510#msg742510 date=1274591912]@mr.mogudu thank u fr d complement.....nd *=[img]http://i44.tinypic.com/cj968.jpg[/img][/quote] ^^" #~` ~"! *=: you rock (*" cheers12w welcome
Item Rajaa... Posted May 23, 2010 Report Posted May 23, 2010 enti baa post vesindi nuvve ga malli good post ani smiley use chesthunnav............[img]http://i47.tinypic.com/9zy23s.jpg[/img]
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=Item Rajaa... link=topic=69802.msg742512#msg742512 date=1274592127]enti baa post vesindi nuvve ga malli good post ani smiley use chesthunnav............[img]http://i47.tinypic.com/9zy23s.jpg[/img][/quote]nee post good post ani vesthunna le. nekoti cheppanaa? rajamouli ganuka.....NTR tho movies teeyakunda...ave movies ni pawankalyan tho tesi untey...nuvvu kuda tittevaadivemo mama...rajamouli ni....what say?
Item Rajaa... Posted May 23, 2010 Report Posted May 23, 2010 adi nijame le......kani ram charan ke hit ichadu ika pawan tho hit ivvatam emundi.........within few days sunil is also going to rock as maryada ramanna........................hero evaraina director okkade....STUDENT NO1SIMHADRISYECHATRAPATHIVIKRAMARKUDUYAMADONGAMAGADHEERA [img]http://i39.tinypic.com/24wwxox.jpg[/img]
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=Item Rajaa... link=topic=69802.msg742514#msg742514 date=1274592477]adi nijame le......kani ram charan ke hit ichadu ika pawan tho hit ivvatam emundi.........within few days sunil is also going to rock as maryada ramanna........................hero evaraina director okkade....STUDENT NO1SIMHADRISYECHATRAPATHIVIKRAMARKUDUYAMADONGAMAGADHEERA [img]http://i39.tinypic.com/24wwxox.jpg[/img][/quote]STUDENT NO1 = K.Raghavendra RaoSIMHADRI = Braveheart fight sequence...other than that movie story line is good....acceptedSYE = haha....ilanti movies enni unnayo english lo...lolzCHATRAPATHI = Interval bang...prince of persia game fights lol...navvaleka sacham po....VIKRAMARKUDU = routine.....bad choice of hero.....i love to watch Pawan Kalyan in this movie....just imagine PK in that railway station scene. YAMADONGA = remake ye kadaMAGADHEERA = haha....combo of many english moves.....300 fight...adi cheppalaa? what next?
POOLA RANGADU Posted May 23, 2010 Report Posted May 23, 2010 SS..RAJAMOULI.... *u( *u( ...racha rangadee..7 cinemalu.....BOMBU lee ...asala..okkoti...okko volcano...Nitin gaadiki kudaa jeevitam lo kanii veinii erugani..oohinchaleni HIT ichaadu....SYE cinema tho.Prabhas ki Mass Image ichaadu...Chatrapati thooRavi teja laanti tingaroodiki kudaa..VIKRAMARKUDU tho oka range ichaadu...inka...NTR jr. ni nilabettina teeru cheppanavsaram ledu..novice ayina...ram charan laanti vaadikeee..anni daggarundi choopinchi...nerpinchi...chivariki ela gola mukki mulgi......cinema poorth icheesi....MAGADHEERA tho ..oka gurtimpu teesukochaadu...alaantidi ..RAJAMOULI ki enti mama? Rajanikanth ee rajamoli tho teeddaam ani egabadutuntee....
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=POOLA RANGADU link=topic=69802.msg742533#msg742533 date=1274593221]SS..RAJAMOULI.... *u( *u( ...racha rangadee..7 cinemalu.....BOMBU lee ...asala..okkoti...okko volcano...Nitin gaadiki kudaa jeevitam lo kanii veinii erugani..oohinchaleni HIT ichaadu....SYE cinema tho.Prabhas ki Mass Image ichaadu...Chatrapati thooRavi teja laanti tingaroodiki kudaa..VIKRAMARKUDU tho oka range ichaadu...inka...NTR jr. ni nilabettina teeru cheppanavsaram ledu..novice ayina...ram charan laanti vaadikeee..anni daggarundi choopinchi...nerpinchi...chivariki ela gola mukki mulgi......cinema poorth icheesi....MAGADHEERA tho ..oka gurtimpu teesukochaadu...alaantidi ..RAJAMOULI ki enti mama? Rajanikanth ee rajamoli tho teeddaam ani egabadutuntee....[/quote]haha....vaadu entha mandiki mass image isthey enti mama.....adi matter kaadu....copy kotti ivvadame kadaa...all i want to say is he is not a great director. anthey....
Item Rajaa... Posted May 23, 2010 Report Posted May 23, 2010 what next aa..............asalu ee discussion ye waste baa......andariki telsu what is rajamouli ani daniki malli ila negative discussion enduku.....intha slump lo telugu industry lo 7 consecutive hits ichina magadu evadu....haa...............anyone.........brave heart aithe enti prince of persia aithe enti .....manaki nachindha ledha anthe.......comment chese hakku manaki ledhu baa.....if u like us give comp-lement ...if u dont like it jus dont watch his movies dats it...ila copy anatam enduku.......telugu audiance english and hindi movies antha ga chudaru le....b and c class ki kavalsindi masala adi untadi rajamouli movies lo....................[img]http://i42.tinypic.com/2af0ew0.jpg[/img]
prayanam Posted May 23, 2010 Report Posted May 23, 2010 [quote author=Mr.MOGUDU link=topic=69802.msg742539#msg742539 date=1274593432]haha....vaadu entha mandiki mass image isthey enti mama.....adi matter kaadu....copy kotti ivvadame kadaa...all i want to say is he is not a great director. anthey....[/quote]nuvvu naaku ardam kavu vitleroooooooooooooo vitleruuuuuuuuuuuuuuuu
prayanam Posted May 23, 2010 Report Posted May 23, 2010 [quote author=Item Rajaa... link=topic=69802.msg742543#msg742543 date=1274593604]what next aa..............asalu ee discussion ye waste baa......andariki telsu what is rajamouli ani daniki malli ila negative discussion enduku.....intha slump lo telugu industry lo 7 consecutive hits ichina magadu evadu....haa...............anyone.........brave heart aithe enti prince of persia aithe enti .....manaki nachindha ledha anthe.......comment chese hakku manaki ledhu baa.....if u like us give comp-lement ...if u dont like it jus dont watch his movies dats it...ila copy anatam enduku.......telugu audiance english and hindi movies antha ga chudaru le....b and c class ki kavalsindi masala adi untadi rajamouli movies lo....................[img]http://i42.tinypic.com/2af0ew0.jpg[/img][/quote][img]http://lh3.ggpht.com/_qqmYhkE9U2A/SiFtbTkY-QI/AAAAAAAADlU/-zFVzRRCVro/bean.gif[/img]
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=Item Rajaa... link=topic=69802.msg742543#msg742543 date=1274593604]what next aa..............asalu ee discussion ye waste baa......andariki telsu what is rajamouli ani daniki malli ila negative discussion enduku.....intha slump lo telugu industry lo 7 consecutive hits ichina magadu evadu....haa...............anyone.........brave heart aithe enti prince of persia aithe enti .....manaki nachindha ledha anthe.......comment chese hakku manaki ledhu baa.....if u like us give comp-lement ...if u dont like it jus dont watch his movies dats it...ila copy anatam enduku.......telugu audiance english and hindi movies antha ga chudaru le....b and c class ki kavalsindi masala adi untadi rajamouli movies lo....................[img]http://i42.tinypic.com/2af0ew0.jpg[/img][/quote]ilane brastu pattinchedhi janam kuda. netho disco waste mama....infact naatho disco waste mama...nuvvu happy ga velli rendu pegs vesi rajamouli cinema chudu. cheers12w cheers12w cheers12w
prayanam Posted May 23, 2010 Report Posted May 23, 2010 [quote author=Mr.MOGUDU link=topic=69802.msg742547#msg742547 date=1274593739]ilane brastu pattinchedhi janam kuda. netho disco waste mama....infact naatho disco waste mama...nuvvu happy ga velli rendu pegs vesi rajamouli cinema chudu. cheers12w cheers12w cheers12w[/quote][img]http://i59.photobucket.com/albums/g291/emmasholi/Requests/Set1bAv.png[/img]
Adolf Hitler Posted May 23, 2010 Author Report Posted May 23, 2010 [quote author=Prayanam link=topic=69802.msg742550#msg742550 date=1274593802][img]http://i59.photobucket.com/albums/g291/emmasholi/Requests/Set1bAv.png[/img][/quote][img]http://i44.tinypic.com/2e1w10k.jpg[/img]
Item Rajaa... Posted May 23, 2010 Report Posted May 23, 2010 @Mogadu .....manam okarni great kaadhu ani analem ...anali ante manam thanakante manchi position lo undali....dats it.......intha discussion enduku le kani...ala copy chesi nuvvu hit kottu baa....appudu rajamouli waste ani oppukunta..............jus try to do it.......mana industry lo andaru copy cats ye.....kani hit kottali ante dedication and audiance pulse teliyali ......appudu product confirm hit avuthundi....
.thumb.jpg.ce42bb16ec102475a78c2087ce269c7d.jpg)
.thumb.gif.343fe49c7e1c507ae0056326bd8cf77e.gif)
Recommended Posts